DPCstruct | MC13470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8QEI8 | 1-113 | MNRGVDLLIAYRVIKLLVTPFNKQEAFKLGIIDEKGTVLRKYRTLAKPKEKRAYTMLHRFVFNLKRILAKVGIRGALGSFAVAAALL… |
| A0A836XF52 | 1-107 | MSGIVDTYITYRIITTLVKDWDEQEAYKYGIIDEKGKVLRKYKELKVRKEKESYTILIRFIFNLKRLMEKIPGGKNKIGSYAIAALI… |
| A0A382Y4K7 | 1-102 | None |
| A0A2E9QJX1 | 7-95 | None |
| A0A2E2ZCP8 | 1-110 | None |
| A0A2D5MSW9 | 1-110 | None |
| A0A2E9JBM4 | 13-116 | None |
| A0A1Z9T235 | 4-96 | None |
| A0A7J4UP39 | 1-108 | None |
| A0A7J4UNE5 | 4-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.