DPCstruct | MC13469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 56 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5JLR6 | 91-157 | ASFEVWKFFSKYDINGLISPPMSIGVYVKQKELVKVIDLFGRESKDKNQLLFYIYDDGTVEKRIIIE |
| A0A800JN21 | 197-245 | VSAINDFNNNQKTLIKVVDVLGKETNIQKNCTLYYIFDDGTVEKKIIIE |
| A0A2D5PTA4 | 392-444 | None |
| A0A2E7TSU2 | 206-261 | None |
| A0A2E1SIC3 | 318-365 | None |
| A0A2E1TE31 | 88-171 | None |
| A0A2E5XTJ3 | 265-347 | None |
| A0A2E5LE04 | 105-152 | None |
| A0A2D5G0D7 | 178-225 | None |
| A0A2E4WQA8 | 739-795 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.