DPCstruct | MC13467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 568 ± 68 aa |
| Standard deviation of domain lengths | 68.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7T0R6 | 323-777 | HSKKHGFVLNAAGIHGHHGKHGNVGTTGTSGYSGVCREGPGTEGGPGGVGGPGDFGQRGQDATEASDVILSLYGNNESLHVSGSCKF… |
| A0A800EAD0 | 17-581 | QQGLSGINGISGQSGSSGQKGETGKKHGSKGRGGSNGSNGSNAESHGGNGENGASGSDGSDVESRISLEESQIYYSNNHIKSIEIYP… |
| A0A3D8QXJ6 | 3-704 | None |
| A0A6A5CA72 | 103-726 | None |
| A0A1F3VP71 | 18-554 | None |
| A0A267E439 | 1-515 | None |
| A0A150WQ05 | 57-590 | None |
| D2VRW2 | 1-564 | None |
| D2VUT6 | 10-485 | None |
| A0A6A6YX93 | 105-684 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.