DPCstruct | MC13463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 141 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060R664 | 138-277 | MRAAFSRVYGEIKDWCGEHYDSFPPLIINISDGEATDSTERELVEVVAQIKTLQTSDGEPILMNIHLSGSSESSIIFPENESELPED… |
| A0A177QUW8 | 1-142 | MCQGFKLAKQIVDEFVGKYPGCYPPQVINITEGMATDGPPEPGASALRGVSSKDGNVLLYNAHLSERETQPIEFPEKEDILPDDYAR… |
| A0A1V1PG79 | 285-422 | None |
| A0A814S5Y1 | 218-354 | None |
| A0A6J8EJR6 | 91-226 | None |
| A0A084AR28 | 322-457 | None |
| A0A166WZR1 | 280-425 | None |
| A0A455SMT7 | 661-798 | None |
| S7ZYR3 | 365-488 | None |
| A0A847M3H3 | 577-739 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.