DPCstruct | MC13462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1G7B5 | 1-80 | MPYPNEHACRIRDPGEFTDGSFRRIERGEGKEKISIIIGRPKGQTTTATQAFRYDKKLWAEQRAKTHCNENDGTFEPAAK |
| A0A177QNU5 | 27-100 | AEEHVALLANPDKFDLLRRKADLLDEGVAAVFGLASAKAELLALCFQVTKFTPAEVVNWLAERKIVPLLYVPSS |
| A0A1V5KD99 | 1-73 | None |
| A0A6M3KV54 | 1-92 | None |
| A0A6M3K194 | 3-80 | None |
| A0A7C8EH68 | 1-85 | None |
| A0A3R7HQT8 | 1-88 | None |
| A0A496ZL23 | 318-403 | None |
| A0A1F8MC12 | 4-86 | None |
| A0A0F9S364 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.