DPCstruct | MC13461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3CTS4 | 21-117 | RVRVTSQVNITPFVARQKVNVLMLDKVGNLLHGGEPEMVLSDRLYWRVPVLLSTPSRGLLGQVGAILVNARTGETVADDTTLQDIAD… |
| A0A177QIM4 | 1-97 | MKRATRPKTIDADQAKRVAIAYCLLHYPTLYTAGPPRKEKTGWRVPVMLEDPDAHISAAIGELQLDPRTGMVTTAPSLADVIAAGRR… |
| A0A1E7IIQ4 | 1-91 | None |
| A0A354F287 | 1-73 | None |
| A0A2V8TSU1 | 9-91 | None |
| A0A7C3H1H6 | 19-118 | None |
| A0A6A8AQV4 | 1-79 | None |
| A0A354H0Y1 | 147-219 | None |
| A0A7C7QN56 | 59-152 | None |
| A0A399ZES0 | 110-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.