DPCstruct | MC13460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 228 ± 29 aa |
| Standard deviation of domain lengths | 28.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13827 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1GL78 | 2-228 | SSYAAIAWHPDAADIWVDGNYTGPNAAQQGALEMCNQVMGGGCTSTGEWSNSSMTVIRDRGGDFHNGWNGEGRAGRRQALAECSAKQ… |
| A0A177QII6 | 56-259 | GGVYAAIAFSPSTGVYGSASECSSLADAERIAKTGCHEADVRIVAWAHNSWCALALSEGNTYGIGLAHTRQAAERLALEHCRGRSQK… |
| A0A6P1INB0 | 22-224 | None |
| A0A1M4JAG7 | 50-238 | None |
| A0A1H7Y819 | 57-252 | None |
| A0A357N8X1 | 1-312 | None |
| A0A7V8JGR9 | 63-290 | None |
| A0A0S2FI15 | 83-307 | None |
| A0A4Y6T7W7 | 65-299 | None |
| A0A261SIW8 | 64-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.