DPCstruct | MC1346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J2KWD5 | 2-69 | TKTIIFSAPQGWGKTRNKAKLRAEFGCKQVIDGWSLDDPIQKNGLHLTNVPPGQFRNNKPELYTLVSR |
| A0A0F5PBB0 | 1-86 | MIIVIHGPPACGKTFNRERLREHFGCRRIVDSWDAYSGQGDGRSQRLRDGDLILTCDSPEAIYGSKALRGMSYGVHAFEAAIEAAG |
| A0A7V9IMX3 | 3-79 | None |
| A0A1I3KQF6 | 1-69 | None |
| A0A7X4K9R1 | 5-77 | None |
| A0A1G8CTH4 | 2-76 | None |
| A0A2Z5E7A4 | 6-88 | None |
| A0A7Y3NJ34 | 2-66 | None |
| A0A2G2IYE0 | 2-73 | None |
| A0A844RVT8 | 6-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.