DPCstruct | MC13459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835IMR2 | 92-173 | LSITFPVENRTVPVTMRALKTHLDKAKNLPFVKKISDFYLLLLLSRFLDPNADIPALAECVQTGTSVPKGYQLLIDSVANAS |
| N1QVP0 | 226-304 | LSMGFPIENRGIPLPANALRSHMDRAKHLPFVKRISDFHLLLQIAAFLDVKADVPTLAACVGHQAEVPEGYRLLIDALA |
| A0A2U1N102 | 328-421 | None |
| A0A024G930 | 349-430 | None |
| A0A7S2Z5Q0 | 52-140 | None |
| A0A2G2WMQ2 | 349-433 | None |
| A0A1U8NX31 | 42-123 | None |
| A0A7S0Z2R2 | 117-210 | None |
| A0A4Y7LE16 | 162-240 | None |
| I3RZK2 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.