DPCstruct | MC13458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5MYK9 | 192-306 | PTDLKLCPPELYNDDCRELLAEITVVKGWVRQWLKYVQWYHTIALDPEVSVEAFFKAPVVTSSWKATREDPQLVRFGLMWKLYDEVA… |
| A0A2P5WD47 | 1-110 | MAYLTEVTLLRSWTANWLQYVKWYYTQALLPSVLLKDFFDAPVFTRHWKVKSEDPELIRFGLLWRLYDEVAKKGPSYMGFILADNKL… |
| A0A6V7PYJ7 | 127-218 | None |
| A0A2G2WT26 | 7-105 | None |
| A0A2J6KD10 | 82-176 | None |
| A0A151UDC3 | 1-95 | None |
| A0A0D2LZD6 | 1-100 | None |
| A0A7J0D8K6 | 2-79 | None |
| A0A2Z7D4Z5 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.