DPCstruct | MC13457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5WA22 | 11-142 | LMEEMYANGIEGVDDAPSSSTSTTIQKNRPIISSEQLDIEAYAVLYSGRTKIMRLIFLADHCDNSGMQLEALRMAYDELNKGENTQL… |
| A0A7S4BKF5 | 1-97 | MATSSGSTLDVEAYISHYSGYTRLKRLQFIAQQDAGLRSEALRLAFEEVKKTANVAMYNELVAMDPNAPGVDEAWAKEAKKSSTQTL… |
| A0A5J5VHC8 | 1-141 | None |
| A0A022QUW5 | 1-135 | None |
| A0A438DB35 | 1-129 | None |
| A0A6A6MFD7 | 1-122 | None |
| A0A2P5XHB4 | 1-142 | None |
| A0A392MK25 | 1-105 | None |
| A0A5N5QEY4 | 635-764 | None |
| A0A5N4AFN2 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.