DPCstruct | MC13456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.41 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0199- PF00187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5W8F0 | 5-76 | KLYILLTSSSVAILLLCLGASAEQCGRQVGGALCPNRPCCSQHGWCGTPSKYCGTGCQSQCSGSTPTPILPS |
| A0A835BRE7 | 1-46 | MMTHAQQCGSQAGGAVCANNLCCSQYGYCGLGGDYCGSGCQSGPCY |
| A0A446XUK3 | 1-70 | None |
| A0A835ER57 | 1-60 | None |
| A0A835AQZ6 | 52-116 | None |
| A0A2T7EE32 | 7-83 | None |
| A0A1U8KG53 | 8-77 | None |
| A0A6J0NWX0 | 2-70 | None |
| P85966 | 11-108 | None |
| A0A7I4EJY8 | 209-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.