DPCstruct | MC13455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 60.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5W7X4 | 1-93 | MKRGWYHNVVYLGMEDDMPILTMTCPLSAMESFKSGEIPLCAPSKDYADTLVRGLVEGKQLSEEEATTYIQVIVESSTRSPAIALAE… |
| M4F4E3 | 149-222 | GWYGNVVCVGKESDIPILTMTCTLSVLEKFTSGEVPLRPPAKAYANTLVMGLVEGGRLSEEEAWAYIDNAASKP |
| A0A6A1W220 | 1057-1137 | None |
| A0A835RQB6 | 618-692 | None |
| A0A0A9VDA5 | 1-89 | None |
| A0A0A8YM31 | 311-396 | None |
| A0A445G3P6 | 421-498 | None |
| A0A4D9A997 | 350-426 | None |
| A0A7J6X666 | 949-1025 | None |
| A0A0A9RZI1 | 60-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.