DPCstruct | MC13454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 179 ± 36 aa |
| Standard deviation of domain lengths | 35.75 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 57.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D8XUA4 | 60-222 | TFEDIMDLYLAYLQVSVVNPAMEKALLLLEKFAVDAQNGKIPEDTLRVGAPWRHPPKTDIAVWAKIQLMDFIQSLVNAGFAVNYFAD… |
| A0A2P5W3Z5 | 32-205 | NEASTFEDIVDAYLAYLQVTVVNPSMDKALSFLQKFAIDARSGKILEHRLHFGAPWRHPPSSKDPTICKEWAKIQLMDFVQSLVNAE… |
| A0A4D6MV73 | 111-285 | None |
| A0A484KBW0 | 1-151 | None |
| A0A1J1GXP2 | 362-622 | None |
| A0A178VW95 | 22-170 | None |
| A0A803KN94 | 281-458 | None |
| A0A6P6G3V3 | 360-561 | None |
| A0A445F177 | 39-189 | None |
| A0A2U1P351 | 38-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.