DPCstruct | MC13453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 233 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 22.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 91.41 |
| Assigned Pfam label(s) | CL0264- PF14416- CL0016- CL0650- CL0133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565B7L5 | 1-112 | MFTGRWVKDASYPLYDPSTCPFIRREFACKKNGRPDLDYSSFRWQPQHCKLARFNGVKFLEENKGKKIMFVGDSLSLNQWQSLTCML… |
| A0A2P5VQ06 | 30-164 | LILSLRNHRSYPQHPRPMFQTNRTTCALFAGTWVRDDTYPLYQYSNCPAIDAEFNCQMSGRPDSGYLKYRWQPLNCQLPRFDGLVFL… |
| A0A0D3GF82 | 417-569 | None |
| W1NJ35 | 97-197 | None |
| A0A4S4DP26 | 236-377 | None |
| A0A2I0I7A1 | 95-205 | None |
| A0A5A7UZZ0 | 30-153 | None |
| A0A803QP37 | 260-424 | None |
| A0A835H274 | 32-154 | None |
| A0A6A3B892 | 32-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.