DPCstruct | MC13451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C2CFG6 | 4-99 | THLKPQFVEFIPDQLDDGVLYISERFRTCSHKCCCGCGDEVVLPLSPAEWQLSRDGDFVSLWPSVGNWDYPCRSHYVIRRNQVRWAA… |
| A0A7X3VTJ5 | 1-107 | MKLRPIFVEVLPAFDEIQAGELWISHKHRTINLRCPCGCGELTVLTLHPSRWHVHFDGKSVSLDGPTGGSVWANAACGSHYLVRDNG… |
| A0A7H8SD89 | 48-149 | None |
| A0A0J6VNQ0 | 13-113 | None |
| A0A1H3KSW5 | 46-149 | None |
| A0A558R4N2 | 21-116 | None |
| I3E0U6 | 21-114 | None |
| A0A0H4KU38 | 2-85 | None |
| A0A7X7KLW0 | 4-93 | None |
| A0A495DL95 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.