DPCstruct | MC1345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5P929 | 8-94 | MLPRAFLSTAVLLRIPNYSCSLPTGTTPGKYWRRAAAYRFQEPSDQWLIGQYGEPFPEGHELQGRSPIRWWQVVVTDAPRFWPRDVV |
| A0A316RHW1 | 12-77 | EIDEEYALMTKQTFEGLREYSLTIPSGKYEGKMWKANRGGTWYLYWYDHDDNPEMIKIERREILLL |
| A0A849JQR9 | 114-181 | None |
| A0A149S1L0 | 10-104 | None |
| A0A3N8A9D6 | 13-88 | None |
| A0A7T5FJE7 | 74-151 | None |
| A0A3S3S6Q0 | 9-99 | None |
| A0A100HNB5 | 103-185 | None |
| A0A7X4GLW9 | 39-113 | None |
| H8H3U5 | 13-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.