DPCstruct | MC13449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.25 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0123- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S6FVC0 | 2-60 | IEMYHGGPVGIGTLAVNIAEDRETVEDMYEPYLIQKGFLMRTKQGRKVTQRAYEHLGYV |
| A0A7W4HNE3 | 3-72 | GLDPADRNLLQSILENYGDNPVGLTTIAALTGDEATTIEDFYEPYLLQIGFIERTPRGRRVTIKAKRHLG |
| A2ZIZ7 | 120-207 | None |
| A0A149SWB9 | 1-64 | None |
| A0A0F9MHR9 | 190-254 | None |
| A0A813ASQ0 | 249-335 | None |
| A0A4U9HI38 | 1-53 | None |
| A0A7W0G8J2 | 14-93 | None |
| A0A318B323 | 2-68 | None |
| R7K7E0 | 405-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.