DPCstruct | MC13448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A135V874 | 13-119 | MVARVSADKHRLCACISDQGLVGVQIDDDATKAVVNAYDGRFIYAGGNWFSDELHGAPYSGSYWHAIEGSVNGATDDGWVGGDEAHG… |
| A4F4L2 | 2-111 | VIYLPLYLLVLGIATTTISQPHLLCACESGRRDGVDDTRTLKVVKGTGGRFVFSSRYWTKAEGAPHEGNYAHAINGTITKKGTNIQA… |
| A0A517LIZ0 | 1-133 | None |
| E5A7M2 | 1-123 | None |
| A0A517LCM4 | 1-133 | None |
| A0A4Z1P6L9 | 1-121 | None |
| A0A4Z1NNJ9 | 14-122 | None |
| F9GAQ9 | 89-213 | None |
| A0A517LAX4 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.