DPCstruct | MC13440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8VQ72 | 4-130 | DIMYQYGFNEQDGNFQYDNFGRGGKDRDDIEVYIHYNGFTSNADCFTLFDGQHGIILMGIYTTTRPNRDSVLDSSILAHELGHSLSD… |
| R8BM05 | 1-129 | MYHDLLYELGFNEAAGNFEVNNNGKGGKANDFVILNAQDGAGTNNADFSTPPDGQMGRMRMYIWTYSTPNRDCAFEAGVIIHEYTHG… |
| A0A822DAH1 | 16-102 | None |
| A0A0L0TEY5 | 81-160 | None |
| A0A7C2RIJ5 | 3-109 | None |
| A0A177WYC6 | 29-124 | None |
| A0A423WJ79 | 6-97 | None |
| A0A7W1JAY8 | 15-106 | None |
| A0A832MD61 | 1-127 | None |
| L8WNM0 | 94-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.