DPCstruct | MC1344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I6S2Z2 | 2-68 | TNAIPIPAPECPLCGRPNDCAPARSGNFDTPCWCLQARIPAELVDSLPEAVRGRACICRDCVASHGE |
| A0A2V4VWK7 | 1-59 | MHCPICNQPNECGIQTVQENGAECWCFHETFPKELLQQIPINKRGKACICKRCLVAYEA |
| A0A847NLN1 | 111-167 | None |
| A0A1W9W196 | 1-63 | None |
| A0A841UBT8 | 30-97 | None |
| A0A259JU25 | 71-135 | None |
| A0A7X6WBT6 | 4-58 | None |
| A0A3D3D7I2 | 1-65 | None |
| A0A519F1D7 | 17-78 | None |
| A0A265Q4W5 | 52-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.