DPCstruct | MC13438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 172 ± 40 aa |
| Standard deviation of domain lengths | 40.05 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 21.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7RYQ6 | 24-185 | FVKTVKPIRIQSCPGHILTFPPRQTPNSSYPFMLHDQMDLPWDYQSCGTIMILRASSCTGKALYRQACCSCSELENNYNLIVIKYHI… |
| A0A6A4I5H1 | 4-117 | EWCPGSKITWASNQNLFISFPWARLATSTQAALPVLLEIHNKGRTVVAWSKDCTGSSETCPKCQLLPELFDGVEKVARKAAPGTNYE… |
| A0A5C3K9J5 | 1-162 | None |
| A0A369J7W8 | 34-171 | None |
| A0A146H7B7 | 273-410 | None |
| A0A0C2YDX8 | 105-252 | None |
| K5VBY4 | 1-196 | None |
| A0A0B7FRE2 | 109-316 | None |
| A0A0C9V762 | 115-302 | None |
| A0A0D0BZY6 | 41-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.