DPCstruct | MC13437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 404 ± 64 aa |
| Standard deviation of domain lengths | 64.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7V4W1 | 27-436 | DAIRTKLGRLSPLAWRLAELYDRLDCGQYGPVVSTPTNAHGWIDPRVFVERVSQLQQRGITVGKLDFIGGLLRLAPDFRAAALQTAE… |
| A0A1U9NS13 | 114-482 | HRGHEECAQEGLEVVIAARLREIAYTLLSKDPLPFLLSTPTWDTGALEAAELVERLTAYRRLGVRPGPADFGQALLRVRRDDPAAGT… |
| A0A3S3Q147 | 578-1093 | None |
| A0A2P9IAH8 | 47-389 | None |
| A0A496PHN9 | 393-833 | None |
| A0A1B9M026 | 3-386 | None |
| A0A3P1WVP2 | 264-622 | None |
| A0A4V5V0H4 | 276-633 | None |
| A0A2Z5QZX9 | 53-446 | None |
| A0A5J6U270 | 8-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.