DPCstruct | MC13435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9WPQ0 | 23-146 | RAQTKAMLLPMNVVMARQVSLENHLSLETLRSGVAGEHQFNGICQAYCIARFLHEAGYGGSRDNLFEEAERVLLHCRATADKTGDWW… |
| A0A7T4N8T3 | 2-117 | LLPMSTAIAQRISLENHLSLETLRSGAGGEHHFNGMCQAACIASLLCEAGYGTAREGLFGEAERVLLDCRRAGIETENWRFDGKSYR… |
| A0A4R7QF06 | 64-207 | None |
| A0A158A995 | 2-119 | None |
| A0A4R1MA13 | 21-172 | None |
| A0A1E7W651 | 14-133 | None |
| A0A2Z6IAK9 | 4-154 | None |
| A0A158JKE4 | 30-179 | None |
| A0A4R4C566 | 1-97 | None |
| A0A8B0M278 | 11-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.