DPCstruct | MC13432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06703 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1PWM7 | 58-121 | LMVSSKLPRFSDMYTLTIASADPKSISAKPTVEFTKSVTKWFTKDGVLVEGLFWKDVEGLINDY |
| A0A7N5K2G9 | 2-81 | ILKDPIGMDPDYIWQLPSSLKRFNDKYILKLTFMSGRTNQHRESEYNKSMAKFFDHSATLVMDAYKPEISRLHHILATER |
| A0A3B5Q7X8 | 314-399 | None |
| A0A6A5E006 | 139-225 | None |
| A0A835JUW9 | 152-225 | None |
| A0A5N5TNS2 | 15-100 | None |
| A0A0A9NVD8 | 2-59 | None |
| A0A1I8FI48 | 96-182 | None |
| A0A3L6G046 | 9-79 | None |
| A0A183VJ50 | 28-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.