DPCstruct | MC13431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 223 ± 17 aa |
| Standard deviation of domain lengths | 17.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 72.32 |
| Assigned Pfam label(s) | PF16208- PF00038- PF04732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9WFX5 | 1-228 | MSFHFSSCSTALPGHGTQVPLSSMSPCGFGSSSSSHLYGLGTSQPRVAMCSSYRGPVGAGIREVTINQSLLTPLQVDIDASIQQVRQ… |
| A0A7N5JZX5 | 1-229 | MSTRSTSSSYRRMFGGGRPSSTRSISSSTRYTLGSSIRPSSVRLVSSPGGIYASKAVRVRSSFPPLRLGSDSLVDFTLADAINTEFK… |
| A0A1S3GGS7 | 23-274 | None |
| A0A401SLV7 | 7-228 | None |
| A0A5C6NZ02 | 78-302 | None |
| A0A671U6Y5 | 1-216 | None |
| A0A402FLM3 | 3-178 | None |
| A0A1S3LG13 | 11-229 | None |
| A0A667XUV3 | 5-229 | None |
| A0A6P3WDU7 | 5-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.