DPCstruct | MC13430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8A2R5 | 6-130 | GSLRVRAQLGLPPLLLLTVALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYACQRGCRLFSICQFVDDGIDLNRT… |
| A0A7N5JPQ3 | 25-133 | DPEPASEAFEPALGNTVLCQRTCQNTYPLHTYPKEEELYACQRGCRLFSICQFVDDGIDLNQTKMECDSACTEAYPSPSDEQYACHL… |
| A0A6A1Q533 | 1-135 | None |
| A0A7J7XM86 | 13-130 | None |
| A0A6J0VP80 | 88-217 | None |
| A0A671E312 | 6-133 | None |
| A0A5F8AHT5 | 1-127 | None |
| T1J5P0 | 34-148 | None |
| A0A3M0KCA4 | 19-130 | None |
| A0A402ER01 | 30-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.