DPCstruct | MC1343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 220 ± 59 aa |
| Standard deviation of domain lengths | 59.03 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.21 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.19 |
| Pfam Score | 30.00 |
| Assigned Pfam label(s) | CL0193- PF16086- PF07639 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2BB47 | 8-176 | TITMLYFTSCKKDCQTFENGTISFFTEHKDFVVIDAEFEAVEEVKLLKEAHKSSGAKFETVTEQVLERFAYTEYNIKEEHAFQIVSN… |
| A0A1J4MXE9 | 21-220 | VSSTQVEKNVIEVPELHFHERYAAVDIPIVQEKIRYEPKEVIQEREVHVVKPMYKEKIVEVPHYKVVEKVIEVPQVVLQEKLVEVER… |
| A0A6L3ZCQ8 | 121-438 | None |
| A0A7C1RAM0 | 11-138 | None |
| A0A1C6C0J9 | 234-469 | None |
| A0A1Y1RAI0 | 40-284 | None |
| A0A2T1DMF2 | 89-261 | None |
| A0A7Y2CQ41 | 16-350 | None |
| A0A517SYM0 | 194-523 | None |
| A0A072N7L1 | 223-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.