DPCstruct | MC13428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 87 ± 23 aa |
| Standard deviation of domain lengths | 23.27 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.79 |
| Pfam Score | 97.53 |
| Assigned Pfam label(s) | PF00285- PF00237- PF07123- CL0123- PF00203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z1TQ99 | 1-54 | MFLERSSYISENQINKVVKIHNGKEFVEVLVIKSIVGIKAGCFAPTRKPRKNKK |
| A0A7N5JI01 | 15-99 | QRRLNPGLWRKPWHSLLEHLWKAKKEEHLRDMIIMPKMAGSMVAVYNGKTFSRMEIKPEMIGHYLGKFFTTYKLIKHCRLGIRTT |
| A0A287AQP3 | 23-108 | None |
| A0A5N6PFG2 | 792-901 | None |
| A0A5N6PGC9 | 505-614 | None |
| A0A420HV77 | 3-78 | None |
| A0A1D6F7A4 | 47-132 | None |
| A0A841D260 | 4-77 | None |
| A0A7N0UYM4 | 9-87 | None |
| A0A6A2YBI0 | 4-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.