DPCstruct | MC13427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 4.51 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0Z068 | 2-86 | EINERGNQVERSFFPTERYRWDFNRKFTAAGWEQYDTSQDAWYFGVWVNKRLLQIQTYAEGDLTLVKCPDAEHFNAEIKSMNEFY |
| W7XAY5 | 62-147 | KRTASGAVIRSWFIEGGTAHSINDLTRSEEGWKHYSTYEDAWYFSVRFNPNSLEIMTYAEQDVMLVICESEDQFKCELKAMASFYG |
| A0A432DHX8 | 81-160 | None |
| A0A2W4UDH6 | 217-302 | None |
| I5B178 | 32-115 | None |
| A0A6L8E454 | 2-83 | None |
| A0A2D6XA11 | 100-185 | None |
| A2SNF7 | 12-104 | None |
| A0A0W0VHN1 | 1-87 | None |
| A0A6G9QP52 | 85-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.