DPCstruct | MC13426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 121 ± 22 aa |
| Standard deviation of domain lengths | 22.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7PA72 | 95-231 | RPLKLSDLTHAFVERDNLLSVIDFVHPITESGLYSDETLAEVRKRYPTAEIVRFADWQARKAAVQDRAVAWREVTADEYHDQLGSLP… |
| W7XAW8 | 15-125 | GQFSRETIEQLGRRYPGVYIDEMDTVMEQKRTLYRRQFDVIDEDGFMEALEALPPVGWRRADGVESFKMSERIFDNITAIYCRLKSL… |
| A0A558HMP2 | 32-165 | None |
| A0A4P5QN16 | 134-262 | None |
| A0A8B2YM12 | 16-135 | None |
| A0A1E5BIQ4 | 151-278 | None |
| A0A840CHB3 | 203-327 | None |
| A0A7H4M7K5 | 11-108 | None |
| A0A645IH86 | 4-81 | None |
| N9FDG8 | 124-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.