DPCstruct | MC13425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H3TRD6 | 4-150 | KYQEITGKDKYLKYAEMLAKGIQYMIDENGQTSHILNYPSLSVKEKFRIVYYDGEAALGLLRLYQINKNKDLLDTVKLMFDNFIIKK… |
| W7X1K8 | 1-111 | MQDAATGAFVHVLEFPSLAVKEVHRTVYYDGEAAFGLLKAYQLTGERRYLEAVERAVEYFIQAQHWRSHDHWLAYAVNELTRLAPQE… |
| A0A645G541 | 1-120 | None |
| A0A2X4ZDI7 | 1-124 | None |
| A0A4R6FYC9 | 344-471 | None |
| R2SB10 | 325-472 | None |
| A0A378AF69 | 26-150 | None |
| A6GMC9 | 287-434 | None |
| A0A1I8ATN9 | 280-426 | None |
| A0A2D5GEG7 | 317-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.