DPCstruct | MC13420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257H2W2 | 1-116 | MNEIFPARYAAVAPVSTKTRAEVVADMAEAKRTGNVMASTQVAIDYAGTTSAKMNEVFPSRYPAVAAAPTKTRADVRTELAEAQRTG… |
| W7WT81 | 65-180 | RHRRRLIALSATQVFAADGPKTRDQVRAELAEAIRTGNMPANGESGVLLNQVNPGRYAPQNMEAGKTRAEVKAELMEALRTGDVLAN… |
| A8JJ64 | 106-214 | None |
| A0A2W4VZE3 | 1-107 | None |
| A0A2P9H401 | 1-125 | None |
| A0A167H733 | 22-151 | None |
| A0A1Y2QGY3 | 1-136 | None |
| A0A255ZJV9 | 1-143 | None |
| A0A7Y8KYB3 | 1-123 | None |
| A0A2N4UI29 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.