DPCstruct | MC1342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 15.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.94 |
| Pfam Score | 92.17 |
| Assigned Pfam label(s) | CL0229- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4J1P2 | 3-100 | FSICQDCLGDQTRLTRAQNGAECKICTLPFTVYHFKANSKVNRTLICHNCSKQRNVCQCCMLDLQWHIPIELRDRILSSVQGTQVAT… |
| A0A1J4MVU6 | 3-117 | IYEECDFPISCGNCLGDTQYLRMVRSNNEKSCKLCNRPCTSFRWKFNNSNKYKQTVICKTCAQLKNVCQVCVSDINYGIPLSLLDNY… |
| A0A6J1WA25 | 16-127 | None |
| C9SBS0 | 22-137 | None |
| A0A835HBZ5 | 1-107 | None |
| A0A835JSS1 | 16-123 | None |
| A0A0V0QD81 | 1-124 | None |
| A0A2G5EDI6 | 1-97 | None |
| R1EQ39 | 1-120 | None |
| U6LIH2 | 21-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.