DPCstruct | MC13419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 554 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | CL0418- PF11149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7WQY0 | 16-115 | LLSEVAALPGLPGVYRYFDAQGQLLYVGKARNLKKRVSSYFQKTHGGTRIGHMVGKIVRMETTVVRSEAEALLLENNLIKTLAPKFN… |
| A0A2S9HMM0 | 10-104 | SLSIPVSEIHQVSSDSGFYFMRDSNGKIVYTGESLNLRKRLTKHMAGKSSTTKRFYHVFHSVDVFYCDRKDRKIYEMYAINLYNPIG… |
| A0A7I7NXZ3 | 1-160 | None |
| A0A7S2SCE1 | 84-201 | None |
| A0A259TJX2 | 6-106 | None |
| A0A1G2YB03 | 27-168 | None |
| A0A654B1E0 | 7-116 | None |
| A0A285NHP4 | 2-159 | None |
| G8SF70 | 4-90 | None |
| A0A7W0PI73 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.