DPCstruct | MC13417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 73.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0EMK6 | 119-194 | LPSSTNPTLPYTVNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDIGAFSLTSSDSQAMGRVGE |
| W7WMY5 | 1-69 | MPYTVNTLDEHVDMLMVCHHLDASIPEDLAFAESRIRRETIAAEDMLHDMGAISIMSSDSQAMGRVARS |
| A0A0K2RJH6 | 107-192 | None |
| A0A3S4NQ97 | 402-479 | None |
| A0A379FJW8 | 179-261 | None |
| A0A827FSK0 | 84-160 | None |
| A0A8A3T7U5 | 296-373 | None |
| A0A7J0EYN6 | 12-90 | None |
| A0A024UWJ6 | 556-628 | None |
| A0A061DY07 | 576-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.