DPCstruct | MC13415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 263 |
|---|---|
| Mean domain length (aa) | 183 ± 35 aa |
| Standard deviation of domain lengths | 34.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 26.78 |
| Pfam Score | 99.30 |
| Assigned Pfam label(s) | PF04577- PF03348- PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7VK58 | 15-225 | SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKA… |
| A0A7S2WNJ7 | 32-210 | AGHASRTLPTVKASVEDMLGADIETGGLWDPFNFAKDGEAALYRRRCVEIKHGRVAMIATIGYVMGDLITFPGYLSKTQDIKFSDVP… |
| A0A2G3D4L8 | 8-178 | None |
| A0A803QCU9 | 2-155 | None |
| A0A6V7P979 | 2-157 | None |
| A0A812N5W7 | 87-284 | None |
| A0A287HQ72 | 2-108 | None |
| A0A1E7FDM5 | 13-191 | None |
| K0THN8 | 41-203 | None |
| A0A7I4ENA8 | 2-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.