DPCstruct | MC13414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.22 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF03522- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8X0S2 | 3-72 | TATRAILKLGIKPIHTKNWRPQILVYLPVDDSLQFRHLGLLDLVHQLKAGHGLTLVVCIIEGDVVERHED |
| A0A3S5B684 | 1-89 | MALLSLRASKEWGDATRGLQLSTAKRAILKLGDRPIHTKNWRPQLLVYLSLDDSLQVHHERMLDLVYQLKAGRGKLYFVDASWQRQK… |
| A0A819RKJ3 | 353-442 | None |
| A0A182K715 | 411-499 | None |
| A0A444U5N5 | 325-411 | None |
| A0A821U9L6 | 1-100 | None |
| A0A402GBU0 | 26-100 | None |
| A0A2H1CSL9 | 86-167 | None |
| A0A336MST6 | 22-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.