DPCstruct | MC13412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 176 ± 22 aa |
| Standard deviation of domain lengths | 22.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453AF55 | 1-193 | SQQSTSCSLALNNFSSQPDGSPEIPKINFHVELDAAKATWLSNDIVMFSTKTGEMLLLTVVYDGRTVRRLDLMKSKASVISSGATTI… |
| A0A7R9K8T2 | 33-196 | ESVNIEVQENVKLTLEGAQASFISYDRLVMSLKSGELFVLTLYADSMRSIRSFHFEKAAASVLTTCMCVCEENYLFLGSRLGNSLLL… |
| A0A1D6EE95 | 96-257 | None |
| A0A3L6FST2 | 343-498 | None |
| A0A7R9B6L2 | 19-165 | None |
| G4VC18 | 300-499 | None |
| A0A553RIT2 | 289-455 | None |
| A0A151NMU6 | 165-342 | None |
| A0A0N1IB36 | 44-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.