DPCstruct | MC13411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 63.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6Q1K3 | 69-161 | FLLKDNYSVGVLAVDPTSFFSGGAILGDRVRMSDIALNKNVYMRSMGTRGKLGGLAKATRAAIHILDIVGMDYIIVETSGVGQSEID… |
| A0A2C9M3T2 | 130-222 | FLTGLGHRVAVLAVDPSSSASGGSLLGDKTRMPELSRDMSAFIRPSPSCGSLGGVTRTTNEAIVLCEGGGFNIILVETVGVGQSEFA… |
| A0A818LMR5 | 156-248 | None |
| D7G5D8 | 278-361 | None |
| A0A183K8I7 | 57-149 | None |
| A0A183WF46 | 59-133 | None |
| A0A183NKV1 | 57-137 | None |
| A0A6N6KEZ6 | 95-178 | None |
| A0A0N4UFY8 | 1269-1360 | None |
| A0A7M7SWP6 | 262-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.