DPCstruct | MC13409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 65.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9HE41 | 163-282 | ENPFYVDTVRSFRDRRYEYKGLNKVWKGKLSEAKAGGNPMKIQEAQDMVVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVT… |
| A0A1U8JS05 | 6-112 | FRLFCSFRDRRYEYKGLNKVWKGKLSEAKAGGNPMKIQEAQDMVVLYDSLQLAHKCILNSFYGYVMRKGARWYLMEMAGVVTYTGAK… |
| A0A813UEE3 | 160-260 | None |
| A0A287F516 | 292-406 | None |
| A0A819M514 | 67-168 | None |
| A0A820SP40 | 116-222 | None |
| A0A819RPB0 | 44-155 | None |
| A0A816HGT7 | 8-117 | None |
| A0A819VWN6 | 44-144 | None |
| A0A1A8EVY7 | 76-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.