DPCstruct | MC13408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 152 ± 18 aa |
| Standard deviation of domain lengths | 17.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819ZMU1 | 23-151 | NPVVICRKIFEYIHEMTVLIRTHLLNGGTDTLYHSETWDLCLRRWLKLEKDFYNIQKDKFNISKVPDIYDSIKYDLLHNKNLLQFPH… |
| A0A3S5AV37 | 11-141 | CDALFGYVQRLAHRVAQLASNLKERGRIRLYQGESWELLLRRWTKLEKDFRSDAHGGYDLSKISDIYDNIKYDVQHNSDILIESEAQ… |
| A0A7S2YUD1 | 3-188 | None |
| A0A453FNT7 | 9-167 | None |
| A0A7J6JVE5 | 105-249 | None |
| A0A1A8J7T2 | 58-201 | None |
| A0A7S0PRY1 | 84-239 | None |
| A0A7J0EKR2 | 511-674 | None |
| A0A4U5M1L9 | 212-356 | None |
| A0A2J8IKB4 | 124-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.