DPCstruct | MC13407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 1 aa |
| Standard deviation of domain lengths | 1.04 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 60.26 |
| Pfam Score | 83.04 |
| Assigned Pfam label(s) | PF20917- CL0040- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9DCB3 | 413-475 | QIVIEEDPSLPKPRKIKIRDATSHRDERVMIQAWVHRIRRQGKTLMFLLLRDGTGFLQCVFSD |
| A0A7J6C5Y8 | 110-172 | IIKNDLSLPEPKTVKIDKLEALREQRVKVFGWVHRLRRQGKNLLFIVLRDGTGFLQCVLTDKL |
| A0A2B4RK77 | 119-181 | None |
| A0A820X703 | 117-179 | None |
| A0A402FI93 | 111-175 | None |
| A0A0V1F762 | 370-432 | None |
| A0A074ZGV2 | 396-459 | None |
| A0A183XAU3 | 1-66 | None |
| A0A820REQ0 | 115-179 | None |
| A0A183JKF7 | 103-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.