DPCstruct | MC13406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.10 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0220- CL0743 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5CRS7 | 2-99 | VQEASVNYNPHTRYTMDALRIGWEQLLTNIKRAQNETENQILTRDAKGISESQIEECRRCFNHFDKQRLRRLEPLDFRACLVSLGYN… |
| A0A3S5AQX1 | 2-110 | IMLIARRLQEAFVFENPYTAFTMETLRVAWEQLISSIRYACNEFENQILTRDSRGLSSEQIEDIRRSFNHFDKDGSRKLSPNEFKAC… |
| A0A238BNM8 | 1-92 | None |
| A0A5B7GDT9 | 32-141 | None |
| A0A2H1CG70 | 79-188 | None |
| A0A7R9DUN2 | 39-147 | None |
| S9X5S1 | 105-242 | None |
| A0A3P7MWU0 | 7-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.