DPCstruct | MC13404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183TBY7 | 2-115 | YRFVAGVLAPCILGRFIRPLLLIILFAWICFCIAIIPTNLKIGLDQRLAMPLGSYELDYFDAVAKYLAVGPPVYFVVTHGHPYNTLD… |
| A0A3S5AHL7 | 1-103 | MSGWARPLLLSLTVLWICFGLAVIPTHLRIGLDQRLSMPNDSYVLDYFNALSTYLNIGPPVYFVVTREHDYTNRIGQDEVCGSTGCP… |
| A0A183N619 | 274-396 | None |
| A0A2G5UFK4 | 46-147 | None |
| A0A654H8C3 | 16-138 | None |
| A0A5C2T5R6 | 12-104 | None |
| A0A183CX25 | 182-306 | None |
| A0A453CMM2 | 1-115 | None |
| A0A7R9ITE9 | 78-200 | None |
| K7HC82 | 185-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.