DPCstruct | MC13403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 83 ± 3 aa |
| Standard deviation of domain lengths | 3.21 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 71.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671UJE5 | 199-285 | IEDTTDCLSTMACVCRVMLETPEYRCRFTNTDTMLFCMRVMVGVIILYDHVHPVGAFAKTSKIDMKGCIKVLKEQPSNSVEGLLNAL |
| A0A3S5AFR0 | 1-81 | MAAMAHICRGLLAKPELRSRVTREDTLMLCLRVMTGVIILYDHIDPNGVFRKASKMDVKSCIRLLRDQNPETVECLLNAIR |
| A0A493TLK5 | 476-559 | None |
| A0A667Y025 | 219-297 | None |
| K1RH16 | 43-122 | None |
| A0A5C6NH79 | 518-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.