DPCstruct | MC1340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 217 ± 44 aa |
| Standard deviation of domain lengths | 44.08 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4MLF2 | 52-268 | QVIGVLAYNILIWHNLYLGSINPEYILVIDIFYLFIIYIIFLPNLNLLIILGLLGILSPILQNLTSSFSYDTIIILMLIIFALYLLS… |
| A0A1S0UNT7 | 18-226 | KNSSISSVQHFSLIFAIALVLYTVYLYMIRPRNLHDHFYTFIILLCFGYVLTPVIRTLTDTISTDTIYAMSFILFLTSFIFHDYAMV… |
| A0A388L102 | 515-719 | None |
| A0A812SN55 | 67-289 | None |
| A0A2C6A7V0 | 594-794 | None |
| A0A1Y3BM30 | 3-152 | None |
| A0A2P6NWH3 | 70-323 | None |
| W7U9H2 | 26-334 | None |
| A0A7J6PCC8 | 45-253 | None |
| A0A5K4F9K1 | 2-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.