DPCstruct | MC134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538M372 | 5-113 | ARLWFVILAAAEAVIAILVYGDAHSSVRVVAVLFFLLIFPGMAWIRLLQLYEPVTELTLAIALSVAIDAALPGALVYAGGWSAGAAL… |
| A0A842TP71 | 80-205 | KKALDFWISLAIIIIVLPLVLLVPEDSFTSGNGLYFFLGILRMIFGGIITILLPGFGLISTLYPTNKELDTLQRYGLSFGLSIVIVV… |
| M0BMF0 | 24-157 | None |
| A0A533W8Q3 | 81-199 | None |
| A0A347ACQ6 | 485-593 | None |
| A0A1V5B553 | 10-130 | None |
| A0A419K8Z0 | 17-140 | None |
| A0A5A7RR26 | 9-118 | None |
| A0A147JWX8 | 3-106 | None |
| A0A3A5HFN7 | 660-774 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.