DPCstruct | MC13396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 63 ± 1 aa |
| Standard deviation of domain lengths | 0.53 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 92.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 47.21 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF04983- PF04998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JQH2 | 68-130 | VLSEPSVDKERTTSNDIVEIFSCLGIEAVRRSIEKEMNHVISFDGSYVNYRHLSLLCDIMTCK |
| A0A1U7LM42 | 109-171 | VMNTKGVVGEKRYTNHVMEMKDVLRIEAARNSIINEINTTMTSHGMNIDPRHMMLLGDVMTYK |
| L7JZK3 | 3-64 | None |
| A0A438G1C6 | 105-167 | None |
| A0A811P049 | 84-146 | None |
| A0A3B4ASF4 | 51-113 | None |
| A0A1F6ZR17 | 25-86 | None |
| A0A0S7JEG0 | 68-130 | None |
| A0A822GHM5 | 69-131 | None |
| A0A023GIC2 | 43-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.