DPCstruct | MC13394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 17.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TBT1 | 2-116 | IGAKERSRIWDQPQFWEDAFLDAVARERDLIGLDHSPTALLERYSKLSIPERKLWDLKEDRILATVLHNLIAYMVMMKAAKQEIYNV… |
| A0A3S4ZBX8 | 1-149 | MYRFHKDRLVKCTEVSYSLGVNSRIYLFEPLLSVKSRSRIWDNLQMWEDAFFDSIAQERDIIGLDQAPLESMAHYQSLGPNERRQLE… |
| A0A158RDF0 | 841-1020 | None |
| A0A183SGD7 | 58-210 | None |
| A0A0X3NGW3 | 76-229 | None |
| A0A401RT97 | 218-370 | None |
| A0A818GAJ0 | 510-654 | None |
| A0A183H7Q2 | 212-355 | None |
| W6UM61 | 1-136 | None |
| R7VCW9 | 117-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.